| Target Molecule | PTH (1-34) (human) Acetate |
| Synonyms | Teriparatide Acetate; hPTH (1-34) acetate; rhPTH(1-34); human parathyroid hormone (1-34) acetate |
| CAS Number | 99294-94-7 (acetate); 52232-67-4 (free peptide) |
| Sequence (3-Letter) | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence (1-Letter) | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Molecular Formula | C₁₈₁H₂₉₁N₅₅O₅₁S₂ (free peptide) |
| Molecular Weight | 4117.8 |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥98%, ≥99% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (customizable content) or other specified salts |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) and Fragment Condensation |
| Modification Options | Targeted oxidation, deamidation standards, isotope labeling |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | COA, HPLC, MS, and extended regulatory documentation provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
PTH (1-34) (human) Acetate (CAS 99294-94-7) is a 34-amino acid peptide corresponding to the biologically active N-terminal region of human parathyroid hormone. We target this complex sequence to provide high-purity reference standards and raw materials for pharmaceutical research and analytical development.
We utilize optimized solid-phase peptide synthesis (SPPS) and fragment condensation techniques. This approach ensures precise amino acid coupling and minimizes deletion sequences across the 34-residue chain, yielding highly pure materials that meet rigorous pharmaceutical specifications.
Yes. The PTH (1-34) sequence contains sensitive methionine, asparagine, and glutamine residues. We utilize targeted modification techniques to intentionally synthesize specific oxidation and deamidation products, which serve as critical reference standards for stability-indicating assays.
Our infrastructure scales production from milligram-level analytical batches to kilogram-level commercial manufacturing. We optimize liquid-phase handling and large-scale preparative HPLC to maintain consistent impurity profiles across all production volumes.
We operate as a technical partner offering complete peptide CDMO solutions. Our team manages sequence optimization, impurity profiling, analytical method validation, and regulatory documentation to support complex drug development pipelines.
PTH (1-34) (human) Acetate, defined by the sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, is a highly complex 34-residue peptide. Synpeptide provides comprehensive synthetic solutions for this molecule, utilizing its structural challenges to demonstrate our advanced capabilities in pharmaceutical peptide manufacturing and analytical development.
Constructing a 34-amino acid chain requires exact control over coupling efficiency and aggregation. Our custom peptide synthesis platform utilizes optimized Solid-Phase Peptide Synthesis (SPPS) and fragment condensation protocols. This systematic approach ensures high-fidelity assembly of the PTH (1-34) sequence, consistently delivering raw materials with stringent purity profiles (typically ≥98% via HPLC) for advanced research.
The PTH (1-34) sequence is susceptible to degradation, specifically oxidation at the methionine residues and deamidation at the asparagine and glutamine sites. Through our peptide modification services, we systematically control these variables. We also synthesize these specific degradation variants on demand. Providing these defined impurity standards is essential for researchers conducting stability testing and validating analytical methods.
Transitioning long peptides from analytical scale to commercial volumes presents significant engineering challenges. We execute large-scale peptide synthesis for PTH (1-34) by optimizing liquid-phase condensation and high-capacity preparative HPLC purification. This infrastructure guarantees a stable supply chain, smoothly scaling from milligram research quantities to kilogram commercial batches with exact lot-to-lot reproducibility.
We provide structural engineering and manufacturing capacity as a fully integrated peptide CDMO. Our technical teams support pharmaceutical developers through process optimization, rigorous stability assessments, and complete analytical documentation. We deliver the precise data and scalable manufacturing required to advance complex peptide APIs through the development lifecycle.
