| Product Name | PTH (1-34) (human) Acetate |
| Synonyms | Teriparatide Acetate; hPTH (1-34) acetate; rhPTH(1-34); human parathyroid hormone (1-34) acetate |
| CAS Number | 99294-94-7 (acetate); 52232-67-4 (free peptide / teriparatide) |
| Sequence (3-Letter) | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence (1-Letter) | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (34 residues; free acid C-terminus) |
| Molecular Formula (free peptide) | C₁₈₁H₂₉₁N₅₅O₅₁S₂ |
| Molecular Weight (free peptide) | 4117.8 |
| Category | Drug Peptide – parathyroid hormone fragment PTH (1-34) (PTH1 receptor agonist) |
| Purity | ≥98% (by HPLC); pharmaceutical-grade and reference-standard specifications available |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (acetic-acid content typically 2–7% per specification) |
| Water Content | Per specification (Karl Fischer) |
| Related Substances | Controlled per specification; individual impurity reference standards available (e.g. methionine-oxidation and deamidation products) |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – kg (research, reference-standard, and development / API quantities) |
| QC Documentation | COA, HPLC, MS identity; extended API / regulatory documentation on request |
| Usage | For research and pharmaceutical manufacturing or analytical development use only, including as a reference standard or active pharmaceutical ingredient for licensed manufacturers. Not for human or veterinary use; not for sale to patients or individuals. Customers are responsible for regulatory and intellectual-property compliance in their territory. |
PTH (1-34) (human) Acetate is the acetate salt of teriparatide, the biologically active N-terminal fragment of human parathyroid hormone (PTH). It is a thirty-four-residue peptide, one-letter sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, with a free acid C-terminus. The free peptide carries CAS 52232-67-4 and the acetate salt carries CAS 99294-94-7, and the free peptide has the molecular formula C181H291N55O51S2. We make it in-house and supply it as a lyophilized powder for research and pharmaceutical manufacturing use.
PTH (1-34) keeps the part of parathyroid hormone that activates the PTH1 receptor, a G-protein-coupled receptor on bone and kidney cells. In research, intermittent exposure to the fragment shifts bone turnover toward bone formation, which is the basis for its use as an anabolic agent in approved osteoporosis medicines. This is provided as factual background; the material we supply is for research and pharmaceutical manufacturing, is not for human or veterinary use, is not for sale to patients, and we make no health or therapeutic claims.
Teriparatide is the free peptide (CAS 52232-67-4), while teriparatide acetate (CAS 99294-94-7) is the same peptide as its acetate salt. The acetate is the usual form in which the peptide is isolated, handled, and supplied, with the acetic-acid content set within a defined range. The peptide sequence is identical in both; the salt form mainly affects counter-ion content, handling, and the values reported on the certificate of analysis.
We supply PTH (1-34) Acetate as a synthetic peptide at high HPLC purity with a certificate of analysis, an HPLC chromatogram, and mass-spec identity confirmation. Pharmaceutical-grade and reference-standard specifications are available, including controlled related substances such as oxidation and deamidation products, and extended documentation for regulatory and analytical work. Salt form, purity, acetate content, and quantity can be set to your specification.
No. PTH (1-34) Acetate supplied by SynPeptide is a raw material for research and pharmaceutical development and manufacturing only. It is not a finished medicine, it is not for human or veterinary use, and it is not sold to patients or individuals for personal use. Any clinical or commercial medicinal use is the responsibility of an appropriately licensed party and is subject to the relevant regulatory approvals.
PTH (1-34) (human) Acetate, the acetate salt of teriparatide, is the biologically active fragment of human parathyroid hormone (PTH) and a well-established peptide drug substance for bone metabolism. It reproduces the first 34 amino acids of the 84-residue hormone and is the active peptide behind approved anabolic osteoporosis medicines. We supply it as a synthetic peptide for research and pharmaceutical manufacturing, including as a reference standard and active pharmaceutical ingredient for licensed development work. It is not supplied as a finished medicine and not for human use.
Full-length parathyroid hormone is an 84-residue peptide made by the parathyroid glands that helps regulate blood calcium and bone remodelling. The 1-34 fragment, teriparatide, holds the N-terminal region that binds and activates the PTH1 receptor, so it carries the receptor activity of the whole hormone in a shorter, easier-to-make peptide. Its sequence is H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH (one-letter SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF), with a free acid C-terminus. The free peptide has the molecular formula C181H291N55O51S2 and a molecular weight of about 4117.8; as the acetate salt its formula is C183H295N55O53S2.
PTH (1-34) is an agonist of the PTH1 receptor (also called the PTH/PTHrP receptor), a G-protein-coupled receptor found mainly on bone and kidney cells. A defining feature in research is that the effect on bone depends on how it is given: continuous exposure tends to favour bone breakdown, while intermittent exposure favours bone formation, which is why the fragment is studied as an anabolic, bone-building agent. This is provided as factual background; the material we supply is for research and pharmaceutical development, not for human or veterinary use, not for sale to patients, and carries no health or therapeutic claims.
The free peptide is teriparatide (CAS 52232-67-4); the acetate salt is teriparatide acetate, or PTH (1-34) (human) Acetate (CAS 99294-94-7). The peptide is identical in both, and the acetate is simply the salt form in which the peptide is usually purified and supplied. The acetic-acid content is set within a defined range, and the certificate of analysis reports the acetate level, water content, and peptide content for each lot. We can supply the free peptide or the acetate, with the salt form and counter-ion content set to your specification.
PTH (1-34) is a long peptide with two methionine residues, so it needs careful synthesis and tight control of oxidation and deamidation. We make it by solid-phase synthesis, including fragment-condensation approaches that suit a peptide of this length, and release it with full analytical data. As a peptide synthesis and peptide CDMO provider, we work with it as an active pharmaceutical ingredient and reference standard, and individual impurity and related-substance reference standards, such as methionine-oxidation and deamidation products, can be prepared alongside the main compound for regulatory and stability work.
Store the lyophilized peptide at -20°C, kept dry and protected from light. Because the sequence contains two oxidation-sensitive methionine residues, handle it under inert gas where possible and keep it away from strong oxidants; the asparagine and glutamine residues also make it prone to deamidation under harsh conditions. Reconstitute in a suitable aqueous buffer, aliquot stock solutions to avoid repeated freeze-thaw, and follow the certificate of analysis for lot-specific acetate and water content.
For comparative and method-development work we can supply PTH (1-34) together with related parathyroid-hormone fragments, sequence variants, and labelled forms, prepared through peptide modification and held under our drug peptides range. Sourcing a compound and its impurity standards from the same batch keeps purity, salt form, and counter-ion consistent across a study.
We make PTH (1-34) (human) Acetate by solid-phase and fragment-condensation synthesis and release it with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with grade and salt form set to your specification. Supply runs from milligram research and reference quantities through to development and larger batches, handled by our large-scale peptide synthesis and custom peptide synthesis capabilities. Material is supplied for research and pharmaceutical manufacturing use only; customers are responsible for the regulatory and intellectual-property requirements that apply in their territory.
