| Product Name | Teriparatide (PTH 1-34) |
| Synonyms | Parathyroid Hormone (1-34) (human), hPTH(1-34), PTH 1-34, Forteo, LY333334; catalog code CNV-38d(1-34) |
| CAS Number | 52232-67-4 (free base); acetate salt 99294-94-7 |
| Sequence (3-Letter) | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence (1-Letter) | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Molecular Formula | C₁₈₁H₂₉₁N₅₅O₅₁S₂ |
| Molecular Weight | 4117.72 |
| Category | Drug Peptide – PTH(1-34) / Anabolic Bone Agent |
| Purity | ≥98% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (TFA-free available; salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water and dilute acetic acid |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – kg (research quantities to scale-up batches) |
| QC Documentation | COA, HPLC, MS identity (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
Teriparatide is a synthetic 34-amino-acid peptide made up of the first 34 residues of human parathyroid hormone, so it is often written PTH(1-34) (CAS 52232-67-4; acetate salt 99294-94-7). Its sequence is SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF. It is known as a medicine under the brand name Forteo. We supply it as a white powder for research and pharmaceutical development.
Teriparatide is an agonist at the parathyroid hormone type-1 receptor (PTH1R). The N-terminal region, residues one to thirty-four, carries the active part of the full eighty-four-residue hormone. Given intermittently, it stimulates bone-forming cells, the osteoblasts, which is why it is described as an anabolic, bone-building peptide rather than one that only slows bone loss.
Clinically, teriparatide is used as a bone-forming treatment for osteoporosis, including in postmenopausal women and in men at high risk of fracture. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply Teriparatide with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture Teriparatide in-house and supply from research quantities up to scale-up batches. Contact us with your required purity, salt form, and quantity for a quote.
Teriparatide is a synthetic peptide corresponding to the first 34 amino acids of human parathyroid hormone. As the active fragment of the natural hormone, it is an anabolic, bone-building peptide and is known as a medicine under the brand name Forteo. We supply it as a raw material for research and pharmaceutical development.
Teriparatide is a 34-residue peptide with the sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, the N-terminal 1-34 portion of the 84-residue human parathyroid hormone. Its free-base CAS number is 52232-67-4 (the acetate salt is 99294-94-7), its molecular formula is C181H291N55O51S2, and its molecular weight is about 4118. In some catalogues, including this listing, it is also referenced by the code CNV-38d(1-34).
Teriparatide is an agonist at the parathyroid hormone type-1 receptor (PTH1R), acting through the same N-terminal region that makes natural parathyroid hormone active. Where continuous high levels of parathyroid hormone tend to break bone down, intermittent exposure to teriparatide favours the bone-forming osteoblasts, so it is classed as an anabolic agent that builds bone rather than only slowing its loss.
Teriparatide is used clinically as a bone-forming treatment for osteoporosis, including in postmenopausal women and in men at high risk of fracture, and was the first approved anabolic agent for osteoporosis. This information is provided as scientific and reference background only. The material supplied by SynPeptide is intended for research and pharmaceutical manufacturing, is not for human or veterinary use, and is not for sale to patients; any therapeutic use is subject to applicable regulatory approval.
We supply Teriparatide with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with further documentation available to support active pharmaceutical ingredient and regulatory work. As a 34-residue peptide it calls for careful synthesis and purification; purity, salt form, and counter-ion can be set to your specification for use as a reference standard or in process development.
We manufacture Teriparatide by solid-phase synthesis and supply it from research quantities through to scale-up batches. For related capabilities, see drug peptides, custom peptide synthesis, large-scale peptide synthesis, and our peptide CDMO services. Material is supplied for research and pharmaceutical manufacturing use only.