| Product Name | Salmon Calcitonin |
| Synonyms | Calcitonin salmon; Calcitonin (salmon); Salcatonin; salmon calcitonin (1-32); sCT |
| CAS Number | 47931-85-1 |
| Sequence (3-Letter) | H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 |
| Sequence (1-Letter) | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (32 residues; C-terminal amide) |
| Disulfide Bridge | Cys1–Cys7 (intramolecular) |
| Molecular Formula | C₁₄₅H₂₄₀N₄₄O₄₈S₂ |
| Molecular Weight | 3431.9 |
| Category | Drug Peptide Impurity / Reference Standard – calcitonin (salmon) |
| Purity | ≥98% (by HPLC); reference-standard and pharmaceutical-grade specifications available |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (per specification) |
| Disulfide Bridge | Cys1–Cys7 (intramolecular) |
| Water Content | Per specification (Karl Fischer) |
| Related Substances | Characterised per specification; named impurity / related-substance reference standards available |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg quantities (reference-standard and research); larger scale on enquiry |
| QC Documentation | COA, HPLC, MS identity; extended characterisation (related substances, peptide content) on request |
| Usage | For research and pharmaceutical analytical / quality-control use only, including as a reference standard for identity and related-substance testing. Not for human or veterinary use; not for sale to patients or individuals. Customers are responsible for regulatory and intellectual-property compliance in their territory. |
Salmon Calcitonin, also written calcitonin (salmon), is a thirty-two-residue peptide hormone with CAS 47931-85-1 and the molecular formula C145H240N44O48S2. Its one-letter sequence is CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP with a C-terminal amide, and it has an intramolecular disulfide bridge between the cysteine residues at positions one and seven. We make it in-house and supply it as a synthetic lyophilized powder for research and analytical use, including as a reference standard.
Analytical and quality-control work needs a well-characterised reference standard of the active peptide to confirm identity, calibrate assays, and run system-suitability and related-substance tests. Salmon calcitonin reference material is used this way in the control of calcitonin (salmon) drug substances and products. We supply it with full identity and purity data so it can serve as the parent reference alongside named impurity standards.
Like other disulfide-containing amidated peptides, salmon calcitonin can form a defined set of related substances during synthesis and storage. Common ones include disulfide-bond isomers and the open-chain reduced form, oxidation and deamidation products, acetylated and truncated sequences, and dimers. These are controlled in pharmacopoeial and in-house methods, and we can prepare named impurity and related-substance reference standards alongside the parent peptide for method development and stability work.
We supply Salmon Calcitonin as a synthetic peptide at high HPLC purity with a certificate of analysis, an HPLC chromatogram, and mass-spec identity confirmation. Reference-standard and pharmaceutical-grade specifications are available, including extended characterisation of related substances. Salt form, purity, and quantity can be set to your specification.
No. Salmon Calcitonin supplied by SynPeptide is a raw material for research and pharmaceutical development, analysis, and manufacturing only. It is not a finished medicine, it is not for human or veterinary use, and it is not sold to patients or individuals for personal use. Any clinical or commercial medicinal use is the responsibility of an appropriately licensed party and is subject to the relevant regulatory approvals.
Salmon Calcitonin (CAS 47931-85-1) is a 32-residue peptide hormone from the calcitonin family and a long-established peptide drug substance for bone and calcium metabolism. In a peptide impurity and reference-standard programme it is the parent compound against which related substances are measured, and we supply it as a synthetic peptide for research, analytical, and quality-control use, including as a reference standard. It is not supplied as a finished medicine and not for human use.
Salmon calcitonin is a single-chain peptide of 32 amino acids with a C-terminal amide and an intramolecular disulfide bridge between Cys1 and Cys7. Its sequence is H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (one-letter CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2). Its molecular formula is C145H240N44O48S2 and its molecular weight is about 3431.9. The salmon sequence differs from human calcitonin and is more potent and longer-acting, which is why the salmon form is the one used in medicines and in calcitonin reference standards.
Regulated peptide manufacturing needs reference standards to confirm identity, calibrate assays, and run system-suitability and related-substance tests. As a peptide drug substance with pharmacopoeial monographs, calcitonin (salmon) is routinely controlled this way. We supply well-characterised salmon calcitonin reference material with full identity and purity data, so it can serve as the parent reference alongside named impurity standards in method development, release testing, and stability studies.
Salmon calcitonin is a disulfide-bridged, amidated peptide, so it can form a characteristic set of related substances during synthesis, purification, and storage. Typical ones include disulfide-bond isomers and the reduced open-chain form, oxidation and deamidation products, acetylated and N-terminally modified species, truncated or deletion sequences, and dimers. These are the species that pharmacopoeial and in-house related-substance methods are designed to separate and limit. We can prepare named impurity and related-substance reference standards to order, so a test peptide and its impurity panel can be sourced together with consistent purity and counter-ion.
Calcitonin lowers blood calcium mainly by slowing the bone-resorbing activity of osteoclasts and by increasing calcium and phosphate excretion in the kidney, acting through the calcitonin receptor, a G-protein-coupled receptor. The salmon form is more potent than mammalian calcitonins. This is provided as factual background; the material we supply is for research and analytical use, not for human or veterinary use, not for sale to patients, and carries no health or therapeutic claims.
Store the lyophilized peptide at -20°C, kept dry and protected from light. Because the molecule depends on its Cys1–Cys7 disulfide bridge, avoid reducing conditions and strong oxidants that could open or scramble the bond, and note that the asparagine and glutamine residues make it prone to deamidation under harsh conditions. Reconstitute in a suitable aqueous buffer, aliquot stock solutions to avoid repeated freeze-thaw, and follow the certificate of analysis for lot-specific peptide and water content.
We make Salmon Calcitonin and its related-substance reference standards by solid-phase synthesis with controlled disulfide formation, and release them with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with grade and salt form set to your specification. Impurity and related-substance reference standards are prepared through our peptide modification and custom peptide synthesis services, and this product sits in our drug peptide impurities reference-standard range. Material is supplied for research and pharmaceutical analytical or manufacturing use only; customers are responsible for the regulatory and intellectual-property requirements that apply in their territory.
