| Target Molecule | Nesiritide (hBNP) |
| Synonyms | Natrecor, BNP-32 (human), hBNP, recombinant human B-type natriuretic peptide |
| CAS Number | 124584-08-3 |
| Sequence (3-Letter) | H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (cyclic Cys10–Cys26 disulfide) |
| Sequence (1-Letter) | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Molecular Formula | C₁₄₃H₂₄₄N₅₀O₄₂S₄ |
| Molecular Weight | 3464.04 |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥98%, ≥99% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate, citrate, or custom salt options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) and Directed Disulfide Cyclization |
| Modification Options | Intramolecular disulfide bridging, stable isotope labeling (13C, 15N), fluorescent/biotin tagging |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | COA, HPLC, MS, and extended regulatory documentation provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
Nesiritide (CAS 124584-08-3) is a 32-amino acid human B-type natriuretic peptide (hBNP) characterized by an intramolecular Cys10–Cys26 disulfide bridge. We target this sequence to provide high-purity reference materials and raw materials for cardiovascular and renal research.
We utilize optimized solid-phase peptide synthesis (SPPS) and directed oxidative folding techniques. Our platform ensures high-fidelity chain elongation across 32 residues and precise ring closure between Cys10 and Cys26, preventing linear precursors and polymeric aggregation.
Yes. We provide specialized peptide modification services for natriuretic peptides. Options include site-specific stable isotope labeling (13C, 15N) for quantitative mass spectrometry (LC-MS/MS), fluorescent or biotin tagging, and the synthesis of related peptide impurities.
Our manufacturing infrastructure scales production from milligram-level analytical batches to kilogram-level commercial manufacturing. We optimize liquid-phase handling and large-scale preparative HPLC to maintain consistent impurity profiles and counter-ion control across all volumes.
We operate as a technical partner offering complete peptide CDMO solutions. Our team manages sequence optimization, disulfide verification, analytical method validation, and regulatory documentation to support complex drug development pipelines.
Nesiritide (CAS 124584-08-3), also known as human B-type natriuretic peptide (hBNP) or BNP-32, is a 32-residue peptide containing an essential intramolecular disulfide bridge between Cys10 and Cys26. Synpeptide provides comprehensive synthetic solutions for this molecule, utilizing its structural challenges to demonstrate our advanced capabilities in pharmaceutical peptide manufacturing and analytical development.
Constructing a 32-amino acid chain requires exact control over coupling efficiency and aggregation. Our custom peptide synthesis platform utilizes optimized Solid-Phase Peptide Synthesis (SPPS) protocols and fragment condensation protocols. This systematic approach ensures high-fidelity assembly of the BNP sequence, consistently delivering raw materials with stringent purity profiles (typically ≥98% via HPLC) for advanced research.
The biological activity of Nesiritide relies strictly on the correct formation of the Cys10–Cys26 disulfide macrocycle. Uncontrolled oxidation can lead to inactive linear forms or polymeric aggregates. Through our peptide modification services, we execute precise oxidative folding under high-dilution conditions and verify disulfide connectivity using high-resolution LC-MS/MS and peptide mapping.
Transitioning long disulfide-constrained peptides from analytical scale to commercial volumes presents significant engineering challenges. We execute large-scale peptide synthesis for Nesiritide by optimizing liquid-phase handling and high-capacity preparative HPLC purification. This infrastructure guarantees a stable supply chain, smoothly scaling from milligram research quantities to kilogram commercial batches with exact lot-to-lot reproducibility.
We provide structural engineering and manufacturing capacity as a fully integrated peptide CDMO. Our technical teams support pharmaceutical developers through process optimization, rigorous stability assessments, and complete analytical documentation. We deliver the precise data and scalable manufacturing required to advance complex peptide APIs through the development lifecycle.
