| Product Name | Nesiritide |
| Synonyms | Natrecor, BNP-32 (human), hBNP, recombinant human B-type natriuretic peptide |
| CAS Number | 124584-08-3 |
| Sequence (3-Letter) | H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (disulfide Cys10–Cys26) |
| Sequence (1-Letter) | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (disulfide Cys10–Cys26; 17-membered ring) |
| Molecular Formula | C₁₄₃H₂₄₄N₅₀O₄₂S₄ |
| Molecular Weight | 3464.04 |
| Category | Drug Peptide – B-type Natriuretic Peptide (NPR-A Agonist) |
| Purity | ≥98% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate / citrate (salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – kg (research quantities to scale-up batches) |
| QC Documentation | COA, HPLC, MS identity, disulfide-connectivity confirmation (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
Nesiritide is a recombinant form of human B-type natriuretic peptide (BNP), a 32-amino-acid peptide hormone, known as a medicine under the brand name Natrecor (CAS 124584-08-3). Its sequence, SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, is identical to the body's own BNP and includes a ring formed by a disulfide bond between two cysteines that is needed for activity. We supply it as a white powder for research and pharmaceutical development.
Nesiritide copies the action of the body's BNP. It binds the natriuretic peptide receptor A on the cells lining blood vessels, which raises cGMP inside those cells and relaxes the vessel walls. The result is widening of the blood vessels, a fall in blood pressure, and increased loss of sodium and water by the kidneys. These effects ease the load on a failing heart.
Clinically, nesiritide is given by infusion for acutely decompensated heart failure, in people who are breathless at rest or with little activity. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply Nesiritide with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation, and we can confirm the disulfide connectivity. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture Nesiritide in-house and supply from research quantities up to scale-up batches. As a 32-residue peptide with a disulfide ring it is a demanding synthesis, and we can discuss the right approach for your scale. Contact us with your required purity and quantity for a quote.
Nesiritide is a recombinant form of human B-type natriuretic peptide (BNP), a 32-amino-acid peptide hormone that the heart releases to relax blood vessels and shed fluid. It is known as a medicine under the brand name Natrecor. We supply it as a raw material for research and pharmaceutical development.
Nesiritide has the same 32-residue sequence as the body's own B-type natriuretic peptide, SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. A disulfide bond between Cys10 and Cys26 closes a ring of seventeen residues, and this ring is essential for the peptide to act at its receptor. Its CAS number is 124584-08-3, its molecular formula is C143H244N50O42S4, and its molecular weight is about 3464.
Nesiritide reproduces the action of the heart's own BNP. It binds the natriuretic peptide receptor A on vascular smooth muscle and endothelial cells, a receptor that is itself a guanylate cyclase. Binding raises the level of cyclic GMP (cGMP) inside the cell, relaxing the vessel wall. The overall effect is dilation of both arteries and veins, a lower blood pressure, and increased excretion of sodium and water, which together reduce the workload on a failing heart.
Nesiritide is given clinically by intravenous infusion for acutely decompensated heart failure in people who are short of breath at rest or with minimal activity. This information is provided as scientific and reference background only. The material supplied by SynPeptide is intended for research and pharmaceutical manufacturing, is not for human or veterinary use, and is not for sale to patients; any therapeutic use is subject to applicable regulatory approval.
As a 32-residue peptide that has to fold its disulfide ring correctly, nesiritide calls for careful synthesis and quality control. We supply it with a certificate of analysis, HPLC purity data, mass-spectrometry identity confirmation, and confirmation of disulfide connectivity, with further documentation available to support active pharmaceutical ingredient and regulatory work, and purity and salt form set to your specification.
We manufacture Nesiritide by solid-phase synthesis with controlled disulfide formation, and supply it from research quantities through to scale-up batches. For related capabilities, see drug peptides, custom peptide synthesis, peptide modification, and large-scale peptide synthesis. Material is supplied for research and pharmaceutical manufacturing use only.
