| Target Molecule | Adrenomedullin (AM) (22-52), human |
| Synonyms | Adrenomedullin Fragment 22-52, human; 22-52-Adrenomedullin (human); Human adrenomedullin(22-52); ADM(22-52) |
| CAS Number | 159899-65-7 |
| Sequence (3-Letter) | H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
| Sequence (1-Letter) | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
| Molecular Formula | C₁₅₉H₂₅₂N₄₆O₄₈ |
| Molecular Weight | 3576.1 |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥95%, ≥98% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate, TFA, or custom salt options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) and C-Terminal Amidation Chemistry |
| Modification Options | C-terminal amidation, stable isotope labeling, fluorescent/biotin tagging, full-length agonist analogues |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | COA, HPLC, MS, and extended regulatory documentation provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
Adrenomedullin (22-52), human (CAS 159899-65-7) is a 31-amino acid peptide with a C-terminal amide (TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2), functioning as a competitive antagonist of the adrenomedullin receptor[cite: 7]. We target this sequence to provide high-purity reference materials, analytical standards, and raw materials for cardiovascular research[cite: 7].
We utilize optimized solid-phase peptide synthesis (SPPS) using specialized rink amide resins to ensure complete C-terminal amidation[cite: 7]. Our peptide synthesis platform applies high-efficiency coupling reagents and continuous monitoring to suppress deletion sequences across all 31 residues, achieving superior purity and high yield[cite: 7].
Yes. We provide extensive peptide modification services for adrenomedullin-related peptides[cite: 7]. Capabilities include site-specific stable isotope labeling (13C, 15N), fluorescent and biotin labeling for receptor-binding assays, and parallel synthesis of the full-length agonist Adrenomedullin (1-52)[cite: 7].
Our manufacturing infrastructure scales production from milligram-level research batches to multigram and kilogram commercial quantities[cite: 7]. We optimize fluid handling and preparative HPLC purification, with verified protocols for counter-ion exchange (including TFA removal to acetate), ensuring strict lot-to-lot consistency[cite: 7].
We operate as an integrated technical partner providing complete peptide CDMO solutions[cite: 7]. Our team manages sequence optimization, impurity profiling, analytical method validation, and regulatory documentation to accelerate preclinical research and pharmaceutical development workflows[cite: 7].
Adrenomedullin (22-52), human (CAS 159899-65-7) is a 31-residue peptide amide representing the C-terminal segment of the adrenomedullin hormone[cite: 7]. Acting as a competitive antagonist at adrenomedullin and CGRP receptors, this sequence lacks the N-terminal disulfide loop of the native hormone while requiring precise C-terminal amidation[cite: 7]. Synpeptide provides comprehensive custom synthesis solutions for this molecule, showcasing our technical capabilities in long-chain solid-phase assembly, terminal modification, and CDMO manufacturing[cite: 7].
Constructing a 31-amino acid sequence with alternating polar, basic, and hydrophobic residues presents significant risks of chain aggregation and incomplete coupling cycles[cite: 7]. Our custom peptide synthesis platform resolves these hurdles using optimized Solid-Phase Peptide Synthesis (SPPS) protocols on high-loading amide resins[cite: 7]. By applying high-efficiency coupling reagents and strict environmental controls, we suppress deletion fragments and deliver raw materials with rigorous purity specifications (typically ≥95% or ≥98% via HPLC)[cite: 7].
Receptor pharmacology and structure-activity relationship (SAR) studies frequently require engineered peptide tools[cite: 7]. Through our peptide modification services, we support custom structural modifications of the Adrenomedullin (22-52) backbone[cite: 7]. We routinely incorporate stable isotope labels (13C, 15N) for quantitative LC-MS/MS assays, attach fluorescent dyes or biotin tags for receptor kinetic studies, and synthesize matching pairs with full-length agonists like Adrenomedullin (1-52) to enable comprehensive competitive binding assays[cite: 7].
Transitioning long-chain peptides from laboratory investigation to large-scale supply requires robust process engineering[cite: 7]. We execute large-scale peptide synthesis for Adrenomedullin (22-52) by optimizing fluid dynamics and high-capacity preparative HPLC purification[cite: 7]. Our facilities accommodate demands ranging from milligram research batches to kilogram commercial lots, with validated counter-ion exchange processes that ensure uniform TFA-removed or acetate salt profiles across all production volumes[cite: 7].
We deliver comprehensive technical support as a fully integrated peptide CDMO[cite: 7]. Our technical specialists assist pharmaceutical and academic researchers with process verification, impurity identification, and analytical method validation[cite: 7]. Each batch is accompanied by complete analytical release documentation (including COA, HPLC purity traces, and exact mass confirmation) to facilitate regulatory compliance and reproducible drug discovery programs[cite: 7].
