| Product Name | Adrenomedullin (1-52), human |
| Synonyms | Adrenomedullin (AM), human; ADM (1-52), human; Human adrenomedullin-(1-52)-NH2 |
| CAS Number | 148498-78-6 |
| Sequence (3-Letter) | H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21) |
| Sequence (1-Letter) | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (52 residues; Cys16-Cys21 disulfide) |
| Molecular Formula | C₂₆₄H₄₀₆N₈₀O₇₇S₃ |
| Molecular Weight | 6028.8 |
| Category | Drug Peptide – Adrenomedullin (Vasodilator Peptide) |
| Purity | ≥95% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate or TFA (salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water (dilute acetic acid may aid dissolution) |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – g (research quantities; larger scale on enquiry) |
| QC Documentation | COA, HPLC, MS identity, disulfide-connectivity confirmation (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
Adrenomedullin (1-52), human is the full-length human form of adrenomedullin, a fifty-two-residue peptide hormone (CAS 148498-78-6). Its sequence is YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY with a C-terminal amide, and its two cysteines are joined by a disulfide bridge that forms a small ring near the start of the chain. It belongs to the calcitonin and CGRP peptide family and is a potent vasodilator. We supply it as a white powder for research and pharmaceutical development.
Adrenomedullin works by binding a receptor complex made of the calcitonin-receptor-like receptor together with receptor-activity-modifying proteins, mainly RAMP-two and RAMP-three. Activating this complex raises cyclic AMP inside cells and relaxes blood vessels, which lowers blood pressure. The peptide is produced by endothelial and other cells and also takes part in blood-vessel formation and fluid balance.
Adrenomedullin (1-52) is used in research on the cardiovascular system, blood-pressure regulation, blood-vessel formation, and tumour biology, and is used as a reference standard. These are research findings only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply Adrenomedullin (1-52) with a certificate of analysis, HPLC purity data, mass-spec identity confirmation, and confirmation of the disulfide connectivity. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture Adrenomedullin (1-52) in-house and supply from research quantities up to scale-up batches. As a long fifty-two-residue peptide with a disulfide bridge it is a demanding synthesis, and we can discuss the right approach for your scale. Contact us with your required purity and quantity for a quote.
Adrenomedullin (1-52), human is the full-length human form of the vasodilator peptide hormone adrenomedullin. It belongs to the calcitonin and CGRP peptide family and is widely used as a research peptide. We supply it as a raw material for research and pharmaceutical development.
Adrenomedullin (1-52) is a fifty-two-residue peptide, YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY, with two defining features: a disulfide bridge between Cys16 and Cys21 that forms a small six-residue ring near the N-terminus, and an amide group on the C-terminal tyrosine. It was first isolated from a pheochromocytoma of the adrenal medulla and is encoded by the ADM gene on human chromosome 11p15.4. Its CAS number is 148498-78-6, its molecular formula is C264H406N80O77S3, and its molecular weight is about 6029.
Adrenomedullin acts through a receptor formed by the calcitonin-receptor-like receptor (CRLR) together with receptor-activity-modifying proteins, principally RAMP2 and RAMP3. Activation raises intracellular cyclic AMP and relaxes vascular smooth muscle, producing a potent blood-pressure-lowering effect comparable to that of CGRP. Adrenomedullin is highly expressed in endothelial cells and also participates in blood-vessel formation and fluid balance.
Adrenomedullin (1-52) is used in research on cardiovascular physiology, blood-pressure regulation, endothelial and angiogenesis assays, and tumour biology, and as a reference standard. A shorter fragment, adrenomedullin (22-52), is used in some studies as a receptor antagonist. These are research uses described here as scientific background; the material supplied by SynPeptide is intended for research and pharmaceutical manufacturing, is not for human or veterinary use, and is not for sale to patients.
Because activity depends on the correct disulfide ring and the C-terminal amide, we confirm the disulfide connectivity alongside HPLC purity and mass-spectrometry identity, and supply a certificate of analysis with each batch. Further documentation to support active pharmaceutical ingredient and regulatory work is available on request, and purity and salt form can be set to your specification.
We manufacture Adrenomedullin (1-52) by solid-phase synthesis with controlled disulfide formation and supply it from research quantities through to scale-up batches. As a long fifty-two-residue disulfide peptide it benefits from established large-scale and modification capabilities. For related services, see drug peptides, custom peptide synthesis, large-scale peptide synthesis, and peptide modification. Material is supplied for research and pharmaceutical manufacturing use only.