| Product Name | Pramlintide Acetate |
| Synonyms | Pramlintide, AC-137, Symlin, [Pro25,28,29]-amylin(1-37) (human), tri-proline amylin |
| CAS Number | 196078-30-5 (acetate hydrate); free-base peptide 151126-32-8 |
| Sequence (3-Letter) | H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂ (cyclic Cys2–Cys7 disulfide) |
| Sequence (1-Letter) | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH₂ (Cys2–Cys7 disulfide) |
| Molecular Formula | C₁₇₁H₂₆₇N₅₁O₅₃S₂ (free base) |
| Molecular Weight | 3949.4 (free base); acetate hydrate salt is higher |
| Category | Drug Peptide – Amylin Analog |
| Purity | ≥98% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (supplied as the acetate / acetate hydrate; salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water (the proline substitutions improve solubility over native amylin) |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – kg (research quantities to scale-up batches) |
| QC Documentation | COA, HPLC, MS identity (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
Pramlintide Acetate is the acetate salt of pramlintide, a synthetic 37-amino-acid analog of the human hormone amylin (CAS 196078-30-5; free-base peptide 151126-32-8). Its sequence is KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2, with a disulfide bridge and a C-terminal amide. It differs from human amylin by having prolines at positions twenty-five, twenty-eight, and twenty-nine, which stop it from aggregating. It is known as a medicine under the brand name Symlin. We supply it as a white powder for research and pharmaceutical development.
Pramlintide mimics amylin, a hormone the pancreas releases together with insulin at meals. Acting through amylin receptors, it slows the emptying of the stomach, suppresses the meal-time release of glucagon, and promotes a feeling of fullness. Together these lower the rise in blood sugar after eating. Native amylin clumps into fibrils, but the three proline changes in pramlintide prevent that, giving a stable, usable peptide.
Clinically, pramlintide is used together with mealtime insulin to improve blood-sugar control in type 1 and type 2 diabetes. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply Pramlintide Acetate with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation. Additional documentation for API and regulatory work is available on request, and salt form and purity can be set to your specification.
Yes. We manufacture Pramlintide Acetate in-house and supply from research quantities up to scale-up batches. As a 37-residue, aggregation-sensitive peptide it is a demanding synthesis, and we can discuss the right approach for your scale. Contact us with your required purity and quantity for a quote.
Pramlintide Acetate is the acetate salt of pramlintide, a synthetic 37-amino-acid analog of the human hormone amylin. It is a non-aggregating version of amylin and is known as a medicine under the brand name Symlin. We supply it as a raw material for research and pharmaceutical development.
Pramlintide is a 37-residue peptide with the sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2, a disulfide bridge between the two cysteine residues, and a C-terminal amide. It is human amylin with three changes, prolines in place of the residues at positions twenty-five, twenty-eight, and twenty-nine. Native amylin readily clumps into fibrils, but these proline substitutions block that aggregation while keeping the biological activity, which is what makes pramlintide usable. Its acetate CAS number is 196078-30-5 (free-base peptide 151126-32-8), the free-base molecular formula is C171H267N51O53S2, and the free-base molecular weight is about 3949.
Amylin is a hormone co-secreted with insulin from the beta cells of the pancreas at meals. Pramlintide reproduces its actions through the amylin receptors: it slows gastric emptying, suppresses the post-meal release of glucagon, and promotes satiety through receptors in the brain. The combined effect is a lower rise in blood glucose after eating, complementing what insulin does.
Pramlintide is used clinically together with mealtime insulin to improve blood-sugar control in type 1 and type 2 diabetes. This information is provided as scientific and reference background only. The material supplied by SynPeptide is intended for research and pharmaceutical manufacturing, is not for human or veterinary use, and is not for sale to patients; any therapeutic use is subject to applicable regulatory approval.
At 37 residues, with a disulfide bridge and a tendency to aggregate, pramlintide is a demanding synthesis. We supply it with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with further documentation available to support active pharmaceutical ingredient and regulatory work, and purity and salt form set to your specification.
We manufacture Pramlintide Acetate by solid-phase synthesis, including the disulfide bond and the C-terminal amide, and supply it from research quantities through to scale-up batches. For related capabilities, see drug peptides, custom peptide synthesis, peptide modification, and large-scale peptide synthesis. Material is supplied for research and pharmaceutical manufacturing use only.
