| Target Molecule | Pramlintide Acetate |
| Synonyms | Pramlintide, AC-137, Symlin, [Pro25,28,29]-amylin(1-37) (human) |
| CAS Number | 196078-30-5 (acetate hydrate); 151126-32-8 (free base) |
| Sequence (3-Letter) | H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH₂ (cyclic Cys2–Cys7 disulfide) |
| Sequence (1-Letter) | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH₂ |
| Molecular Formula | C₁₇₁H₂₆₇N₅₁O₅₃S₂ (free base) |
| Molecular Weight | 3949.4 (free base) |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥95%, ≥98% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (standard pharmaceutical salt), TFA, or custom options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) and Directed Disulfide Cyclization |
| Modification Options | Intramolecular disulfide bridging, proline substitution engineering, stable isotope labeling (13C, 15N), C-terminal amidation |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | Comprehensive COA, HPLC, MS, and disulfide connectivity verification provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
Pramlintide Acetate (CAS 196078-30-5) is a 37-amino-acid amylin analogue featuring an intramolecular Cys2–Cys7 disulfide bridge and proline substitutions to prevent amyloid aggregation. We target this sequence to supply high-purity reference materials and raw materials for metabolic and endocrine research.
We utilize optimized solid-phase peptide synthesis (SPPS) and directed oxidative folding techniques. Our platform ensures high-fidelity chain elongation across 37 residues and precise ring closure between Cys2 and Cys7, preventing linear precursors and polymeric aggregation.
Yes. We provide specialized peptide modification services for amylin analogues. Options include site-specific stable isotope labeling (13C, 15N) for quantitative mass spectrometry (LC-MS/MS), fluorescent or biotin tagging, and the synthesis of related peptide impurities.
Our manufacturing infrastructure scales production from milligram-level analytical batches to multigram and kilogram commercial quantities. We optimize preparative HPLC purification and controlled counter-ion exchange (such as acetate salt conversion) to maintain consistent impurity profiles across all volumes.
We operate as an integrated technical partner providing complete peptide CDMO solutions. Our team manages sequence optimization, disulfide verification, impurity profiling, analytical method validation, and regulatory documentation to support complex drug development pipelines.
Pramlintide Acetate (CAS 196078-30-5) is an engineered 37-residue amylin analogue featuring proline substitutions at positions 25, 28, and 29 to disrupt beta-sheet formation, alongside an essential Cys2–Cys7 disulfide bridge. Synpeptide provides comprehensive synthetic solutions for this molecule, utilizing its structural complexity to demonstrate our advanced capabilities in handling aggregation-prone sequences and pharmaceutical peptide manufacturing.
Constructing a 37-amino acid hydrophobic chain requires exact control over coupling efficiency and on-resin aggregation. Our custom peptide synthesis platform utilizes optimized Solid-Phase Peptide Synthesis (SPPS) protocols and chaotropic solvent systems. This systematic approach ensures high-fidelity assembly of the amylin analogue, consistently delivering raw materials with stringent purity profiles (typically ≥98% via HPLC) for advanced research.
The biological activity of Pramlintide relies strictly on the correct formation of the Cys2–Cys7 disulfide macrocycle. Uncontrolled oxidation can lead to inactive linear forms or polymeric aggregates. Through our peptide modification services, we execute precise oxidative folding under high-dilution conditions and verify disulfide connectivity using high-resolution LC-MS/MS and peptide mapping.
Transitioning long, aggregation-prone peptides from analytical scale to commercial volumes presents significant engineering challenges. We execute large-scale peptide synthesis for Pramlintide by optimizing liquid-phase handling and high-capacity preparative HPLC purification. This infrastructure guarantees a stable supply chain, smoothly scaling from milligram research quantities to kilogram commercial batches with exact lot-to-lot reproducibility.
We provide structural engineering and manufacturing capacity as a fully integrated peptide CDMO. Our technical teams support pharmaceutical developers through process optimization, rigorous stability assessments, and complete analytical documentation. We deliver the precise data and scalable manufacturing required to advance complex peptide APIs through the development lifecycle.
