| Product Name | GLP-1 (7-37) |
| Synonyms | Glucagon-like peptide-1 (7-37), Insulinotropin, Proglucagon (78-108) |
| CAS Number | 106612-94-6 |
| Sequence (3-Letter) | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Sequence (1-Letter) | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (31 residues) |
| Molecular Formula | C₁₅₁H₂₂₈N₄₀O₄₇ |
| Molecular Weight | 3355.7 |
| Category | Drug Peptide – GLP-1 Receptor Agonist (Incretin) |
| Purity | ≥98% (by HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (salt form per specification) |
| Peptide Content | ≥80% (per specification) |
| Solubility | Soluble in water |
| Storage | -20°C, desiccated, protected from light |
| Available Scale | mg – kg (research quantities to scale-up batches) |
| QC Documentation | COA, HPLC, MS identity (additional API/regulatory documentation on request) |
| Usage | For research and pharmaceutical development use, and as a reference standard or active pharmaceutical ingredient for manufacturing. Not for human or veterinary use; not for sale to patients. Any therapeutic use is subject to applicable regulatory approval. |
GLP-1 (7-37) is the active form of glucagon-like peptide-1, a natural thirty-one-amino-acid hormone released from cells in the gut after eating (CAS 106612-94-6). Its sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, with no chemical modifications. It is the parent peptide behind the GLP-1 receptor agonist medicines. We supply it as a white powder for research and pharmaceutical development.
GLP-1 (7-37) is an incretin hormone. It binds the GLP-1 receptor and, in a glucose-dependent way, prompts the pancreas to release insulin while lowering glucagon. It also slows the emptying of the stomach and increases the feeling of fullness. In the body the native peptide is broken down quickly, which is why longer-acting analogs were developed.
GLP-1 (7-37) itself is mainly used in research and as the template for the GLP-1 receptor agonist class. Its analogs, which resist breakdown, are established treatments for type two diabetes and weight management. This is background information only; the material we supply is for research and pharmaceutical manufacturing use, and is not for human or veterinary use and not for sale to patients.
We supply GLP-1 (7-37) with a certificate of analysis, HPLC purity data, and mass-spec identity confirmation. Additional documentation for API and regulatory work is available on request, and purity can be set to your specification.
Yes. We manufacture GLP-1 (7-37) in-house and supply from research quantities up to scale-up batches. As a thirty-one-residue peptide it is a demanding synthesis, and we can discuss the right approach for your scale. Contact us with your required purity and quantity for a quote.
GLP-1 (7-37) is the active form of glucagon-like peptide-1, a natural gut hormone that helps control blood sugar after meals. It is the parent peptide behind the GLP-1 receptor agonist class of medicines. We supply it as a raw material for research and pharmaceutical development.
GLP-1 (7-37) is a thirty-one-residue peptide, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, produced when the precursor protein proglucagon is processed in the L cells of the gut. It is a native sequence with no chemical modifications, no D-amino acids, and no disulfide bonds. Its CAS number is 106612-94-6, its molecular formula is C151H228N40O47, and its molecular weight is about 3356.
GLP-1 (7-37) is an incretin hormone. It binds the GLP-1 receptor and, only when blood glucose is raised, stimulates the pancreas to secrete insulin while suppressing glucagon. It also slows gastric emptying and promotes a feeling of fullness. The native peptide has a very short life in the body because the enzyme DPP-4 rapidly degrades it, which is the reason longer-acting analogs were engineered.
The native GLP-1 (7-37) peptide is used mainly in research and as the reference and template for the GLP-1 receptor agonist drug class. Engineered analogs that resist DPP-4, such as exenatide, liraglutide, and semaglutide, are established treatments for type two diabetes and weight management. This information is provided as scientific and reference background only. The material supplied by SynPeptide is intended for research and pharmaceutical manufacturing, is not for human or veterinary use, and is not for sale to patients; any therapeutic use is subject to applicable regulatory approval.
We supply GLP-1 (7-37) with a certificate of analysis, HPLC purity data, and mass-spectrometry identity confirmation, with further documentation available to support active pharmaceutical ingredient and regulatory work. Purity and counter-ion can be set to your specification for use as a reference standard or in process development.
We manufacture GLP-1 (7-37) by solid-phase synthesis and supply it from research quantities through to scale-up batches. For related capabilities, see drug peptides, custom peptide synthesis, and large-scale peptide synthesis. Material is supplied for research and pharmaceutical manufacturing use only.