| Target Molecule | GLP-1 (7-37) |
| Synonyms | Glucagon-like peptide-1 (7-37), Insulinotropin, Proglucagon (78-108) |
| CAS Number | 106612-94-6 |
| Sequence (3-Letter) | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Sequence (1-Letter) | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Molecular Formula | C₁₅₁H₂₂₈N₄₀O₄₇ |
| Molecular Weight | 3355.7 |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥95%, ≥98% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (standard pharmaceutical salt), TFA, or custom salt options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) for Incretin Sequences |
| Modification Options | Side-chain lipidation (Lys acylation), PEGylation, stable isotope labeling (13C, 15N), unnatural amino acid substitution (Aib8) |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | Comprehensive COA, HPLC, MS, and extended regulatory documentation provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
GLP-1 (7-37) (CAS 106612-94-6) is an endogenous 31-amino-acid incretin peptide (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG) serving as the structural blueprint for glucagon-like peptide-1 receptor agonists. We target this sequence to supply high-purity reference materials and raw materials for metabolic, diabetes, and obesity research.
Assembling a 31-residue chain containing hydrophobic domains and oxidation-sensitive Trp25 presents substantial risks of on-resin aggregation and coupling failure. Our peptide synthesis platform utilizes low-loading resins, high-efficiency coupling reagents, and inert gas handling during cleavage to suppress side reactions and ensure high-fidelity sequence elongation.
Yes. We provide specialized peptide modification services for incretin analogues. Capabilities include site-specific side-chain lipidation (such as Lys acylation with fatty diacids), PEGylation, non-natural amino acid substitutions (such as Aib at position 8), and site-specific stable isotope labeling (13C, 15N) for LC-MS/MS bioanalysis.
Our manufacturing infrastructure scales production from milligram-level analytical batches to multigram and kilogram commercial quantities. We optimize preparative HPLC purification and controlled counter-ion exchange (ensuring acetate salt conversion) to guarantee strict batch-to-batch consistency.
We operate as an integrated technical partner providing complete peptide CDMO solutions. Our team manages sequence optimization, impurity profiling, analytical method validation, and regulatory documentation to accelerate complex preclinical and commercial pipelines.
GLP-1 (7-37) (CAS 106612-94-6), also designated insulinotropin, is the native 31-residue incretin peptide acting as the primary physiological ligand for the GLP-1 receptor. Characterized by the sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, it stimulates glucose-dependent insulin secretion and forms the foundation for modern incretin therapeutics. Synpeptide delivers comprehensive custom synthesis solutions for this molecule, showcasing our technical capabilities in long-chain solid-phase assembly, impurity suppression, and CDMO manufacturing.
Constructing a 31-amino acid sequence involves distinct synthetic hurdles, particularly on-resin aggregation across the hydrophobic core (Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val) and incomplete coupling cycles. Our custom peptide synthesis platform resolves these hurdles using optimized Solid-Phase Peptide Synthesis (SPPS) protocols on low-loading resins. By implementing high-efficiency coupling reagents, temperature control, and inert gas handling to protect the sensitive Trp25 residue from oxidative degradation, we suppress deletion fragments, delivering raw materials with rigorous purity specifications (typically ≥95% or ≥98% via HPLC).
Because native GLP-1 (7-37) is rapidly cleaved in vivo by dipeptidyl peptidase-4 (DPP-4) at the Ala8 site, pharmacokinetic exploration requires structurally stabilized analogues. Through our peptide modification services, we perform complex modifications including Lys side-chain acylation with fatty acid spacers, PEGylation, and unnatural amino acid substitutions such as alpha-aminoisobutyric acid (Aib). We also provide heavy stable isotope labeling (13C, 15N) for quantitative bioanalysis and synthesize specific degradation fragments as stability-indicating reference standards.
Moving a 31-residue incretin peptide from laboratory investigation to commercial volume demands robust downstream process engineering. We execute large-scale peptide synthesis for GLP-1 (7-37) and related clinical analogues by optimizing fluid dynamics and high-capacity preparative HPLC purification. Our facilities accommodate requirements from milligram research batches to kilogram commercial lots, ensuring uniform counter-ion exchange (consistently achieving the pharmaceutical acetate salt form) across all production volumes.
We deliver comprehensive technical support as a fully integrated peptide CDMO. Our development specialists assist pharmaceutical partners with process optimization, stability testing, impurity identification, and analytical method validation. Every batch is released with complete analytical documentation—including COA, HPLC purity traces, and exact mass confirmation—ensuring regulatory alignment for downstream therapeutic programs.
