| Target Molecule | Exenatide Acetate (Exendin-4) |
| Synonyms | Exenatide, Exendin-4, Byetta, Bydureon, AC2993, AI3-15415 |
| CAS Number | 141732-76-5 (acetate salt); 141758-74-9 (exendin-4 free base) |
| Sequence (3-Letter) | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ |
| Sequence (1-Letter) | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂ |
| Molecular Formula | C₁₈₄H₂₈₂N₅₀O₆₀S (free base) |
| Molecular Weight | 4186.57 (free base) |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥95%, ≥98% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate (standard pharmaceutical salt), TFA, or custom options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) for Long-Chain Incretin Sequences |
| Modification Options | C-terminal amidation, stable isotope labeling (13C, 15N), methionine oxidation standards, deletion impurity profiling |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | Comprehensive COA, HPLC, MS, and purity verification provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
Exenatide Acetate (CAS 141732-76-5) is a 39-amino-acid synthetic incretin mimetic (exendin-4) featuring C-terminal amidation (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂). We target this sequence to supply high-purity reference materials and raw materials for type 2 diabetes and metabolic disease research.
Assembling a 39-residue linear chain carries cumulative risks of sequence truncation, on-resin aggregation, and oxidation of the Met14 residue. Our peptide synthesis platform utilizes optimized Solid-Phase Peptide Synthesis (SPPS) protocols on low-loading resins, high-efficiency coupling reagents, and inert gas handling during cleavage to ensure high-fidelity sequence elongation.
Yes. We provide specialized peptide modification services for GLP-1 receptor agonists. Options include site-specific stable isotope labeling (13C, 15N) for quantitative mass spectrometry (LC-MS/MS), fluorescent or biotin tagging, and the synthesis of specific oxidized methionine variants or deletion sequences as stability-indicating impurity standards.
Our manufacturing infrastructure scales production from milligram-level analytical batches to multigram and kilogram commercial quantities. We optimize preparative HPLC purification and controlled counter-ion exchange (ensuring acetate salt conversion) to guarantee strict batch-to-batch consistency.
We operate as an integrated technical partner providing complete peptide CDMO solutions. Our team manages sequence optimization, impurity profiling, analytical method validation, and regulatory documentation to accelerate complex preclinical and commercial pipelines.
Exenatide Acetate (CAS 141732-76-5), widely recognized under brand names such as Byetta and Bydureon, is a synthetic 39-amino-acid peptide acting as a GLP-1 receptor agonist (incretin mimetic). Defined by the sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂, it shares significant homology with exendin-4 and plays a vital role in glucose-dependent insulinotropic pathways. Synpeptide delivers comprehensive custom synthesis solutions for this molecule, showcasing our technical capabilities in long-chain assembly, oxidation suppression, and CDMO manufacturing.
Constructing a 39-residue sequence requires exceptional coupling efficiency across numerous cycles to prevent cumulative deletion errors and on-resin aggregation. Our custom peptide synthesis platform resolves these hurdles using optimized Solid-Phase Peptide Synthesis (SPPS) protocols on low-loading resins. By deploying high-efficiency coupling reagents, temperature control, and complete C-terminal amidation, we suppress truncated byproducts, delivering raw materials with rigorous purity specifications (typically ≥95% or ≥98% via HPLC).
The sequence of Exenatide contains a sensitive methionine residue at position 14 that is prone to oxidation during synthesis and handling. Through our peptide modification services, we protect vulnerable residues using inert atmosphere handling and customized scavenger systems during cleavage. Furthermore, we synthesize defined methionine sulfoxide variants and truncated fragments as reference standards, and offer stable isotope labeling (13C, 15N) for pharmacokinetic tracking.
Moving a 39-residue peptide from laboratory research to commercial scale demands robust chemical engineering during downstream chromatographic isolation. We execute large-scale peptide synthesis for Exenatide by optimizing fluid dynamics and high-capacity preparative HPLC purification. Our facilities accommodate requirements from milligram research batches to kilogram commercial lots, ensuring uniform counter-ion exchange (including acetate conversion) and consistent lyophilization profiles across all production volumes.
We deliver integrated technical support as an established peptide CDMO. Our development specialists assist pharmaceutical partners with process optimization, stability testing, impurity identification, and analytical method validation. Every batch is released with complete documentation—including COA, HPLC purity traces, and exact mass confirmation—ensuring regulatory alignment for downstream clinical-stage programs.
