| Target Molecule | Apelin-36 (human) |
| Synonyms | Apelin-36; APJ receptor agonist; Apelin (42-77); preproapelin (42-77) |
| CAS Number | 252642-12-9 |
| Sequence (3-Letter) | H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH |
| Sequence (1-Letter) | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Molecular Formula | C₁₈₄H₂₉₇N₆₉O₄₃S |
| Molecular Weight | 4195.9 |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥95%, ≥98% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Trifluoroacetate (TFA), acetate, or custom salt options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) and Fragment Assembly |
| Modification Options | PEGylation, fluorescent/biotin labeling, truncated active fragments (Apelin-13, [Pyr1]Apelin-13) |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | COA, HPLC, MS, and extended regulatory documentation provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
Apelin-36 (CAS 252642-12-9) is a 36-amino acid basic peptide representing the longest endogenous ligand for the APJ receptor. We target this sequence to provide high-purity reference compounds and raw materials for cardiovascular and metabolic research.
We utilize optimized solid-phase peptide synthesis (SPPS) methodologies. Our peptide synthesis platform ensures high coupling efficiency across all 36 residues, preventing deletion sequences and protecting the single oxidation-sensitive methionine residue to achieve superior purity.
Yes. We provide extensive peptide modification services for the Apelin family. Capabilities include the synthesis of truncated analogues (such as Apelin-13 and [Pyr1]Apelin-13), terminal PEGylation for half-life extension, fluorescent/biotin tagging for binding assays, and unnatural amino acid substitutions.
Our infrastructure scales production from milligram-level lab batches to kilogram-level manufacturing. We optimize liquid-phase handling and large-scale preparative HPLC purification to maintain consistent impurity profiles and counter-ion control across all volumes.
We operate as a technical partner providing complete peptide CDMO solutions. Our team manages process optimization, impurity profiling, stability assessments, and analytical documentation to advance complex research and development pipelines.
Apelin-36, defined by the 36-residue sequence LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF, is the longest natural isoform of apelin. Synpeptide provides comprehensive synthetic solutions for this molecule. Constructing this long, highly basic sequence demonstrates our technical capacity in peptide chemistry, impurity control, and process development.
Constructing a 36-amino acid sequence with multiple arginine and proline residues requires precise control over coupling efficiency and chain aggregation. Our custom peptide synthesis platform utilizes optimized Solid-Phase Peptide Synthesis (SPPS) protocols. By applying high-efficiency coupling reagents and inert gas handling during cleavage to protect the Met34 residue, we ensure exact amino acid alignment and high-fidelity assembly, delivering raw materials with stringent purity profiles (typically ≥95% or ≥98% via HPLC).
To support structure-activity relationship (SAR) studies and receptor pharmacology, researchers frequently require modified apelin sequences. Through our peptide modification services, we routinely synthesize related apelin isoforms, including Apelin-17, Apelin-13, and [Pyr1]Apelin-13. We also provide terminal PEGylation to improve metabolic stability, fluorescent and biotin labels for receptor binding assays, and unnatural amino acid substitutions for investigating biased signaling mechanisms.
Moving a long, highly basic peptide from milligram exploratory quantities to commercial production involves specific chemical engineering challenges. The presence of numerous basic residues requires tailored ion-exchange and preparative reverse-phase chromatography protocols. We execute large-scale peptide synthesis for Apelin-36 by optimizing fluid handling and preparative HPLC purification, ensuring a stable supply chain scaling up to multigram and kilogram quantities with verified lot-to-lot consistency.
We deliver comprehensive technical support as a fully integrated peptide CDMO. Our teams support pharmaceutical developers through process verification, salt exchange (such as TFA removal to acetate), stability testing, and complete analytical method validation. We provide the technical documentation and production capacity necessary to execute complex peptide research and early-stage drug development.
