| Target Molecule | ACTH (1-39), rat |
| Synonyms | Adrenocorticotropic Hormone (1-39), rat; ACTH (1-39) (mouse, rat); α1-39-Corticotropin (rat); Corticotropin A |
| CAS Number | 77465-10-2 |
| Sequence (3-Letter) | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| Sequence (1-Letter) | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
| Molecular Formula | C₂₁₀H₃₁₅N₅₇O₅₇S |
| Molecular Weight | 4582.2 |
| Service Category | Custom Peptide Synthesis / CDMO Manufacturing |
| Synthesis Purity | Customizable (e.g., ≥95%, ≥98% via HPLC) |
| Appearance | White to off-white lyophilized powder |
| Counter Ion | Acetate, TFA, or custom salt options |
| Synthesis Technology | Solid-Phase Peptide Synthesis (SPPS) for Long-Chain Sequences |
| Modification Options | Stable isotope labeling (13C, 15N), fluorescent tagging, truncated active fragments (ACTH 1-24, ACTH 1-10) |
| Available Scale | Milligram (R&D) to Kilogram (Commercial CDMO) |
| Analytical Data | COA, HPLC, MS, and extended regulatory documentation provided per batch |
| Usage | Raw material synthesized strictly for laboratory research, analytical development, and industrial formulation. Not a finished medicine. |
ACTH (1-39), rat (CAS 77465-10-2) is a 39-amino acid regulatory peptide representing the full-length adrenocorticotropic hormone sequence in murine models. We target this sequence to supply high-purity reference materials and raw materials for endocrine, neurological, and metabolic research.
We utilize optimized solid-phase peptide synthesis (SPPS) on low-loading resins. Our peptide synthesis platform applies high-efficiency coupling reagents and continuous monitoring to suppress deletion sequences across all 39 residues, incorporating inert gas handling during cleavage to protect the oxidation-sensitive Met4 and Trp9 residues.
Yes. We provide specialized peptide modification services for ACTH-related sequences. Capabilities include site-specific stable isotope labeling (13C, 15N) for quantitative LC-MS/MS, fluorescent tagging, and the synthesis of established active fragments such as ACTH (1-24) and ACTH (1-10) as comparative analytical standards.
Our manufacturing infrastructure scales production from milligram-level analytical batches to multigram and kilogram commercial quantities. We optimize liquid-phase handling and large-scale preparative HPLC purification, with validated protocols for counter-ion exchange (such as TFA removal to acetate), ensuring strict lot-to-lot consistency.
We operate as an integrated technical partner providing complete peptide CDMO solutions. Our team manages sequence optimization, impurity profiling, analytical method validation, and regulatory documentation to advance complex research and drug development pipelines.
ACTH (1-39), rat (CAS 77465-10-2) is a 39-residue regulatory peptide defining full-length adrenocorticotropic hormone in rodents. Synpeptide delivers comprehensive custom synthesis solutions for this molecule. Constructing a 39-amino acid sequence with sensitive residues demonstrates our technical capabilities in long-chain solid-phase assembly, impurity suppression, and CDMO manufacturing.
Constructing a 39-amino acid chain presents significant risks of chain aggregation, steric hindrance, and incomplete couplings during solid-phase elongation. Our custom peptide synthesis platform resolves these hurdles using optimized Solid-Phase Peptide Synthesis (SPPS) protocols on low-loading resins. By implementing high-efficiency coupling reagents, temperature control, and inert gas handling to protect Met4 and Trp9, we ensure high-fidelity assembly, consistently delivering raw materials with stringent purity specifications (typically ≥95% or ≥98% via HPLC).
Endocrine research and pharmacokinetic assays frequently require specialized derivatives of the ACTH sequence. Through our peptide modification services, we routinely synthesize related active fragments, including ACTH (1-24) and ACTH (1-10). We also provide site-specific stable isotope labeling (13C, 15N) for quantitative mass spectrometry, fluorescent labeling for receptor localization studies, and the synthesis of defined oxidation or deamidation impurity reference standards.
Transitioning a 39-residue peptide from exploratory laboratory scale to commercial supply involves specific chemical engineering challenges. Long-chain peptides often exhibit reduced solubility and complex chromatographic profiles during scale-up. We execute large-scale peptide synthesis for ACTH (1-39), rat by optimizing fluid handling and high-capacity preparative HPLC purification. Our facilities accommodate demands ranging from milligram research batches to kilogram commercial lots, ensuring consistent counter-ion control (including acetate conversion) across all production volumes.
We deliver comprehensive technical support as a fully integrated peptide CDMO. Our development specialists assist pharmaceutical partners with process optimization, stability testing, impurity profiling, and analytical method validation. Every batch is released with complete analytical documentation—including COA, HPLC purity traces, and exact mass confirmation—ensuring regulatory alignment for downstream therapeutic programs.
